PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018237.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 476aa    MW: 54412.9 Da    PI: 7.2448
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018237.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS291.13.1e-89894701373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++ Ll  A+av++++   a + L++l + +s +gd++qR++ayf+  Laarl+   s  y+++  ++ts    +ee+ a+++++ vsP+++f+h+ta
  Pbr018237.1  89 LIHMLLITATAVNENNVGSALEHLTELYKSVSLSGDSIQRVVAYFADSLAARLLTRRSPFYDIIMKEPTS----EEEFVAFTALYRVSPYYQFAHFTA 182
                  6899***************************************************9*****999888885....78889999**************** PP

         GRAS  99 NqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlvakrled 188
                   qaI ea+e+e     +++H+iDfd+s+G+QW++L+q+L++++  ++  slRiTg+g+    s +el+et++rL++f + + ++ fef+ l    l  
  Pbr018237.1 183 IQAIIEAFEKEeeknnRALHVIDFDVSYGFQWASLIQSLSEKAssRKRISLRITGFGR----SVDELRETENRLTSFSKGFqNLAFEFQGL----LRG 272
                  *********9977777788***********************95444559********....9****************9857*******8....666 PP

         GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                   +l +Lr k++E+laVnl ++l +l  +++++++    +Lk v  l+P +v++veqe   +  +Fl rf+e+l+y++a+fdsl++ lp +s er ++E
  Pbr018237.1 273 SKLVNLRKKRNETLAVNLDFHLNTLS-NNLKISD----LLKSVHLLNPSIVILVEQEGTSSPRRFLSRFMESLHYFAAMFDSLDECLPLKSAERLSIE 365
                  67789*****************9997.5566655....************************************************************ PP

         GRAS 287 rellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllr..kvk.sdgyrveee............sgslv.lgWkdrp 366
                  +  lg+ei++++   +++     + e++e+W+ r+e+ GF+ ++ls++   qa+lll+  +++ s  +  e++            +g  + lgW+dr 
  Pbr018237.1 366 KNHLGKEIKSMLNYDNNNddNCPKIEKMETWKVRMESHGFEGINLSSRSKIQARLLLKirTHYcSLQFDGESNgaaagfkvfereDGRTIsLGWQDRH 463
                  ************9776552267799*******************************97322222222322211333333333334454445******* PP

         GRAS 367 LvsvSaW 373
                  L++vSaW
  Pbr018237.1 464 LLTVSAW 470
                  ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.96163435IPR005202Transcription factor GRAS
PfamPF035141.1E-8689470IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MEDIDEEEEL LNLSLAIVTS SGRERFRKRK RSRDDGVVNS SVRPLNSYEG CEGKIFRLLQ  60
MREQMLKNLD HHKKKGVDVD DEDGKGLHLI HMLLITATAV NENNVGSALE HLTELYKSVS  120
LSGDSIQRVV AYFADSLAAR LLTRRSPFYD IIMKEPTSEE EFVAFTALYR VSPYYQFAHF  180
TAIQAIIEAF EKEEEKNNRA LHVIDFDVSY GFQWASLIQS LSEKASSRKR ISLRITGFGR  240
SVDELRETEN RLTSFSKGFQ NLAFEFQGLL RGSKLVNLRK KRNETLAVNL DFHLNTLSNN  300
LKISDLLKSV HLLNPSIVIL VEQEGTSSPR RFLSRFMESL HYFAAMFDSL DECLPLKSAE  360
RLSIEKNHLG KEIKSMLNYD NNNDDNCPKI EKMETWKVRM ESHGFEGINL SSRSKIQARL  420
LLKIRTHYCS LQFDGESNGA AAGFKVFERE DGRTISLGWQ DRHLLTVSAW HCTVP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-38944718375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12232RERFRKRKRSR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375294.10.0PREDICTED: scarecrow-like protein 23
TrEMBLM5VGL50.0M5VGL5_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s11930.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.14e-49SCARECROW-like 21